Description: Peptide to CRF, Human, Rat Form: Lyophilized powder Alternative Names: Corticoliberin, Corticorelin, CRF-41, CRHCAS Number : 86784-80-7Molecular Formula : C208H344N60O63S2Molecular Weight : 4575.5Purity : > 95%Chemical Structure : H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2Application : CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.Storage/Stability : Shipped at 4°C. Store at -20°C for one year.